General Information

  • ID:  hor003831
  • Uniprot ID:  P01203
  • Protein name:  Met-enkephalin
  • Gene name:  pomc
  • Organism:  Camelus dromedarius (Dromedary) (Arabian camel)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camelus (genus), Camelidae (family), Tylopoda (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFM
  • Length:  5
  • Propeptide:  YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous opiates
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 12.8 minutes; /768 seconds ( PubMed ID: 3215483 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01203-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003831_AF2.pdbhor003831_ESM.pdb

Physical Information

Mass: 64519 Formula: C27H35N5O7S
Absent amino acids: ACDEHIKLNPQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: 52 Boman Index: 707
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 1570 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  1063395##3215483
  • Title:  Isolation and structure of an untriakontapeptide with opiate activity from camel pituitary glands.